![]() |
tmap |
Please help by correcting and extending the Wiki pages.
tmap predicts transmembrane segments for an aligned set of protein sequences, utilising the algorithm described in: "Persson, B. & Argos, P. (1994) Prediction of transmembrane segments in proteins utilising multiple sequence alignments J. Mol. Biol. 237, 182-192.". A plot of the propensities to form the middle and the end of transmembrane regions is output. Bars are displayed in the plot above the regions predicted as being most likely to form transmembrane regions. The transmembrane regions for the complete alignment are given first, followed by the predictions for each individual sequence in the alignment.
% tmap opsd.msf -out tmap.res -graph cps Predict and plot transmembrane segments in protein sequences Created tmap.ps |
Go to the input files for this example
Go to the output files for this example
Predict and plot transmembrane segments in protein sequences Version: EMBOSS:6.5.6.0 Standard (Mandatory) qualifiers: [-sequences] seqset File containing a protein sequence alignment -graph xygraph [$EMBOSS_GRAPHICS value, or x11] Graph type (ps, hpgl, hp7470, hp7580, meta, cps, x11, tek, tekt, none, data, xterm, png, gif, pdf, svg) [-outfile] report [*.tmap] Output report file name (default -rformat seqtable) Additional (Optional) qualifiers: (none) Advanced (Unprompted) qualifiers: (none) Associated qualifiers: "-sequences" associated qualifiers -sbegin1 integer Start of each sequence to be used -send1 integer End of each sequence to be used -sreverse1 boolean Reverse (if DNA) -sask1 boolean Ask for begin/end/reverse -snucleotide1 boolean Sequence is nucleotide -sprotein1 boolean Sequence is protein -slower1 boolean Make lower case -supper1 boolean Make upper case -scircular1 boolean Sequence is circular -sformat1 string Input sequence format -iquery1 string Input query fields or ID list -ioffset1 integer Input start position offset -sdbname1 string Database name -sid1 string Entryname -ufo1 string UFO features -fformat1 string Features format -fopenfile1 string Features file name "-graph" associated qualifiers -gprompt boolean Graph prompting -gdesc string Graph description -gtitle string Graph title -gsubtitle string Graph subtitle -gxtitle string Graph x axis title -gytitle string Graph y axis title -goutfile string Output file for non interactive displays -gdirectory string Output directory "-outfile" associated qualifiers -rformat2 string Report format -rname2 string Base file name -rextension2 string File name extension -rdirectory2 string Output directory -raccshow2 boolean Show accession number in the report -rdesshow2 boolean Show description in the report -rscoreshow2 boolean Show the score in the report -rstrandshow2 boolean Show the nucleotide strand in the report -rusashow2 boolean Show the full USA in the report -rmaxall2 integer Maximum total hits to report -rmaxseq2 integer Maximum hits to report for one sequence General qualifiers: -auto boolean Turn off prompts -stdout boolean Write first file to standard output -filter boolean Read first file from standard input, write first file to standard output -options boolean Prompt for standard and additional values -debug boolean Write debug output to program.dbg -verbose boolean Report some/full command line options -help boolean Report command line options and exit. More information on associated and general qualifiers can be found with -help -verbose -warning boolean Report warnings -error boolean Report errors -fatal boolean Report fatal errors -die boolean Report dying program messages -version boolean Report version number and exit |
Qualifier | Type | Description | Allowed values | Default |
---|---|---|---|---|
Standard (Mandatory) qualifiers | ||||
[-sequences] (Parameter 1) |
seqset | File containing a protein sequence alignment | Readable set of sequences | Required |
-graph | xygraph | Graph type | EMBOSS has a list of known devices, including ps, hpgl, hp7470, hp7580, meta, cps, x11, tek, tekt, none, data, xterm, png, gif, pdf, svg | EMBOSS_GRAPHICS value, or x11 |
[-outfile] (Parameter 2) |
report | Output report file name | (default -rformat seqtable) | <*>.tmap |
Additional (Optional) qualifiers | ||||
(none) | ||||
Advanced (Unprompted) qualifiers | ||||
(none) | ||||
Associated qualifiers | ||||
"-sequences" associated seqset qualifiers | ||||
-sbegin1 -sbegin_sequences |
integer | Start of each sequence to be used | Any integer value | 0 |
-send1 -send_sequences |
integer | End of each sequence to be used | Any integer value | 0 |
-sreverse1 -sreverse_sequences |
boolean | Reverse (if DNA) | Boolean value Yes/No | N |
-sask1 -sask_sequences |
boolean | Ask for begin/end/reverse | Boolean value Yes/No | N |
-snucleotide1 -snucleotide_sequences |
boolean | Sequence is nucleotide | Boolean value Yes/No | N |
-sprotein1 -sprotein_sequences |
boolean | Sequence is protein | Boolean value Yes/No | N |
-slower1 -slower_sequences |
boolean | Make lower case | Boolean value Yes/No | N |
-supper1 -supper_sequences |
boolean | Make upper case | Boolean value Yes/No | N |
-scircular1 -scircular_sequences |
boolean | Sequence is circular | Boolean value Yes/No | N |
-sformat1 -sformat_sequences |
string | Input sequence format | Any string | |
-iquery1 -iquery_sequences |
string | Input query fields or ID list | Any string | |
-ioffset1 -ioffset_sequences |
integer | Input start position offset | Any integer value | 0 |
-sdbname1 -sdbname_sequences |
string | Database name | Any string | |
-sid1 -sid_sequences |
string | Entryname | Any string | |
-ufo1 -ufo_sequences |
string | UFO features | Any string | |
-fformat1 -fformat_sequences |
string | Features format | Any string | |
-fopenfile1 -fopenfile_sequences |
string | Features file name | Any string | |
"-graph" associated xygraph qualifiers | ||||
-gprompt | boolean | Graph prompting | Boolean value Yes/No | N |
-gdesc | string | Graph description | Any string | |
-gtitle | string | Graph title | Any string | |
-gsubtitle | string | Graph subtitle | Any string | |
-gxtitle | string | Graph x axis title | Any string | Residue number |
-gytitle | string | Graph y axis title | Any string | |
-goutfile | string | Output file for non interactive displays | Any string | tmap |
-gdirectory | string | Output directory | Any string | |
"-outfile" associated report qualifiers | ||||
-rformat2 -rformat_outfile |
string | Report format | Any string | seqtable |
-rname2 -rname_outfile |
string | Base file name | Any string | |
-rextension2 -rextension_outfile |
string | File name extension | Any string | |
-rdirectory2 -rdirectory_outfile |
string | Output directory | Any string | |
-raccshow2 -raccshow_outfile |
boolean | Show accession number in the report | Boolean value Yes/No | N |
-rdesshow2 -rdesshow_outfile |
boolean | Show description in the report | Boolean value Yes/No | N |
-rscoreshow2 -rscoreshow_outfile |
boolean | Show the score in the report | Boolean value Yes/No | Y |
-rstrandshow2 -rstrandshow_outfile |
boolean | Show the nucleotide strand in the report | Boolean value Yes/No | Y |
-rusashow2 -rusashow_outfile |
boolean | Show the full USA in the report | Boolean value Yes/No | N |
-rmaxall2 -rmaxall_outfile |
integer | Maximum total hits to report | Any integer value | 0 |
-rmaxseq2 -rmaxseq_outfile |
integer | Maximum hits to report for one sequence | Any integer value | 0 |
General qualifiers | ||||
-auto | boolean | Turn off prompts | Boolean value Yes/No | N |
-stdout | boolean | Write first file to standard output | Boolean value Yes/No | N |
-filter | boolean | Read first file from standard input, write first file to standard output | Boolean value Yes/No | N |
-options | boolean | Prompt for standard and additional values | Boolean value Yes/No | N |
-debug | boolean | Write debug output to program.dbg | Boolean value Yes/No | N |
-verbose | boolean | Report some/full command line options | Boolean value Yes/No | Y |
-help | boolean | Report command line options and exit. More information on associated and general qualifiers can be found with -help -verbose | Boolean value Yes/No | N |
-warning | boolean | Report warnings | Boolean value Yes/No | Y |
-error | boolean | Report errors | Boolean value Yes/No | Y |
-fatal | boolean | Report fatal errors | Boolean value Yes/No | Y |
-die | boolean | Report dying program messages | Boolean value Yes/No | Y |
-version | boolean | Report version number and exit | Boolean value Yes/No | N |
The input is a standard EMBOSS sequence query (also known as a 'USA').
Major sequence database sources defined as standard in EMBOSS installations include srs:embl, srs:uniprot and ensembl
Data can also be read from sequence output in any supported format written by an EMBOSS or third-party application.
The input format can be specified by using the command-line qualifier -sformat xxx, where 'xxx' is replaced by the name of the required format. The available format names are: gff (gff3), gff2, embl (em), genbank (gb, refseq), ddbj, refseqp, pir (nbrf), swissprot (swiss, sw), dasgff and debug.
See: http://emboss.sf.net/docs/themes/SequenceFormats.html for further information on sequence formats.
!!AA_MULTIPLE_ALIGNMENT 1.0 opsd.msf MSF: 354 Type: P 15/07/06 CompCheck: 5414 .. Name: OPSD_HUMAN Len: 354 Check: 2647 Weight: 50.00 Name: OPSD_XENLA Len: 354 Check: 2767 Weight: 50.00 // 1 50 OPSD_HUMAN MNGTEGPNFYVPFSNATGVVRSPFEYPQYYLAEPWQFSMLAAYMFLLIVL OPSD_XENLA MNGTEGPNFYVPMSNKTGVVRSPFDYPQYYLAEPWQYSALAAYMFLLILL 51 100 OPSD_HUMAN GFPINFLTLYVTVQHKKLRTPLNYILLNLAVADLFMVLGGFTSTLYTSLH OPSD_XENLA GLPINFMTLFVTIQHKKLRTPLNYILLNLVFANHFMVLCGFTVTMYTSMH 101 150 OPSD_HUMAN GYFVFGPTGCNLEGFFATLGGEIALWSLVVLAIERYVVVCKPMSNFRFGE OPSD_XENLA GYFIFGPTGCYIEGFFATLGGEVALWSLVVLAVERYIVVCKPMANFRFGE 151 200 OPSD_HUMAN NHAIMGVAFTWVMALACAAPPLAGWSRYIPEGLQCSCGIDYYTLKPEVNN OPSD_XENLA NHAIMGVAFTWIMALSCAAPPLFGWSRYIPEGMQCSCGVDYYTLKPEVNN 201 250 OPSD_HUMAN ESFVIYMFVVHFTIPMIIIFFCYGQLVFTVKEAAAQQQESATTQKAEKEV OPSD_XENLA ESFVIYMFIVHFTIPLIVIFFCYGRLLCTVKEAAAQQQESLTTQKAEKEV 251 300 OPSD_HUMAN TRMVIIMVIAFLICWVPYASVAFYIFTHQGSNFGPIFMTIPAFFAKSAAI OPSD_XENLA TRMVVIMVVFFLICWVPYAYVAFYIFTHQGSNFGPVFMTVPAFFAKSSAI 301 350 OPSD_HUMAN YNPVIYIMMNKQFRNCMLTTICCGKNPLGD.DEASATVSKTETSQVAPA~ OPSD_XENLA YNPVIYIVLNKQFRNCLITTLCCGKNPFGDEDGSSAATSKTEASSVSSSQ 351 OPSD_HUMAN ~~~~ OPSD_XENLA VSPA |
The output is to the specified graphics device.
The results can be output in one of several formats by using the command-line qualifier -graph xxx, where 'xxx' is replaced by the name of the required device. Support depends on the availability of third-party software packages.
The device names that output to a file are: ps (postscript), cps (colourps), png, gif, pdf, svg, hpgl, hp7470, hp7580, das, data.
The other available device names are: meta, x11 (xwindows), tek (tek4107t), tekt (tektronix), xterm, text.
Output can be turned off by specifying none (null).
See: http://emboss.sf.net/docs/themes/GraphicsDevices.html for further information on supported devices.
The output is a standard EMBOSS report file.
The results can be output in one of several styles by using the command-line qualifier -rformat xxx, where 'xxx' is replaced by the name of the required format. The available format names are: embl, genbank, gff, pir, swiss, dasgff, debug, listfile, dbmotif, diffseq, draw, restrict, excel, feattable, motif, nametable, regions, seqtable, simple, srs, table, tagseq.
See: http://emboss.sf.net/docs/themes/ReportFormats.html for further information on report formats.
By default the output is in 'seqtable' format.
######################################## # Program: tmap # Rundate: Sun 15 Jul 2012 12:00:00 # Commandline: tmap # [-sequences] ../../data/opsd.msf # -outfile tmap.res # -graph cps # Report_format: seqtable # Report_file: tmap.res ######################################## #======================================= # # Sequence: Consensus from: 1 to: 354 # HitCount: 7 #======================================= Start End TransMem Sequence 43 70 1 YMFLLIvLG-PINFlTLyVTvQHKKLRT 71 98 2 PLNYILLNL--Ad-FMVL-GFT-TlYTS 112 140 3 lEGFFATLGGEiALWSLVVLAiERYvVVC 148 176 4 FGENHAIMGVAFTWvMALaCAAPPL-GWS 201 229 5 ESFVIYMFvVHFTIPmIiIFFCYGqLv-T 256 276 6 IMVi-FLICWVPYA-VAFYIF 285 305 7 PiFMTiPAFFAKSaAIYNPVI #--------------------------------------- #--------------------------------------- #======================================= # # Sequence: OPSD_HUMAN from: 1 to: 354 # HitCount: 7 #======================================= Start End TransMem Sequence 43 70 1 YMFLLIVLGFPINFLTLYVTVQHKKLRT 71 98 2 PLNYILLNLAVADLFMVLGGFTSTLYTS 112 140 3 LEGFFATLGGEIALWSLVVLAIERYVVVC 148 176 4 FGENHAIMGVAFTWVMALACAAPPLAGWS 201 229 5 ESFVIYMFVVHFTIPMIIIFFCYGQLVFT 256 276 6 IMVIAFLICWVPYASVAFYIF 285 305 7 PIFMTIPAFFAKSAAIYNPVI #--------------------------------------- #--------------------------------------- #======================================= # # Sequence: OPSD_XENLA from: 1 to: 354 # HitCount: 7 #======================================= Start End TransMem Sequence 43 70 1 YMFLLILLGLPINFMTLFVTIQHKKLRT 71 98 2 PLNYILLNLVFANHFMVLCGFTVTMYTS 112 140 3 IEGFFATLGGEVALWSLVVLAVERYIVVC 148 176 4 FGENHAIMGVAFTWIMALSCAAPPLFGWS 201 229 5 ESFVIYMFIVHFTIPLIVIFFCYGRLLCT 256 276 6 IMVVFFLICWVPYAYVAFYIF 285 305 7 PVFMTVPAFFAKSSAIYNPVI #--------------------------------------- #--------------------------------------- #--------------------------------------- # Total_sequences: 2 # Total_length: 702 # Reported_sequences: 3 # Reported_hitcount: 21 #--------------------------------------- |
A plot of the propensities to form the middle (solid line) and the end (dashed line) of transmembrane regions is output.
Bars are displayed in the plot above the regions predicted as being most likely to form transmembrane regions.
The text file (specified by the -outfile option) gives a summary of these regions.
The transmembrane regions for the complete alignment are given first, followed by the predictions for each individual sequence in the alignment.
Two sets of transmembrane propensity values are then used for the calculations: one for the middle, hydrophobic portion and one for the terminal regions of the transmembrane sequence spans. Average propensity values are calculated for each position along the alignment, with the contribution from each sequence weighted according to its dissimilarity relative to the other aligned sequences.
Eight-residue segments are considered as potential cores of transmembrane segments and elongated if thier middle propensity values are above a threshold. End propensity values are also considered as stop signals. Only helices with a length of 15 to 29 residues are allowed and corrections for strictly conserved charged residues are made.
The method is more successful than predictions based upon single sequences alone.
Program name | Description |
---|---|
sigcleave | Report on signal cleavage sites in a protein sequence |
This application was modified for inclusion in EMBOSS by
Ian Longden formerly at:
Sanger Institute, Wellcome Trust Genome Campus, Hinxton,
Cambridge, CB10 1SA, UK.
Please report all bugs to the EMBOSS bug team (emboss-bug © emboss.open-bio.org) not to the original author.